PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48431.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 327aa    MW: 36281.8 Da    PI: 9.6343
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48431.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.71.1e-29162217258
   CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  p YVNaKQy++I++RR +Rak+  e+k+ +k rkpy+heSRh hAlrRpRg+gGrF
  KHN48431.1 162 GPTYVNAKQYHGIIRRRLSRAKAVLENKM-IKRRKPYMHESRHLHALRRPRGCGGRF 217
                 79***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.9E-33159220IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.358160220IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.1E-25163217IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-21163185IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-21194217IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MAMQTVYLKE HEGLVYNSVG QLSSVTSAPW WSALGSQPVY GEYCGQIKPF SFEISNYVDQ  60
FPAGKQAVRG VEQLLDKGHT TTQFTIFPDD CKMSGDAENP QATLSLQSSL AEPHNRFEIG  120
FNQPMICAKY PYMDQFYGLF SAFGPQISGR IMLPINLTSD DGPTYVNAKQ YHGIIRRRLS  180
RAKAVLENKM IKRRKPYMHE SRHLHALRRP RGCGGRFLNT KGSTNGNGRN ESKVNKTGGR  240
QLQSSASQSS EVLHSEVGTL NSSKETNRSS PNISGSEVTS MYSREGFDGF SVNRLGSSVH  300
SLVDMVLSRP LNGLQQYQVT AATLKFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-15163221462NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
4g91_A8e-16161220262HAPB protein
4g92_A8e-16161220262HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175194RRRLSRAKAVLENKMIKRRK
2175195RRRLSRAKAVLENKMIKRRKP
3176195RRLSRAKAVLENKMIKRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618539.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_014618540.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_014618541.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_014618542.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_014618543.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_014618544.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_014618545.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLA0A0B2SP750.0A0A0B2SP75_GLYSO; Nuclear transcription factor Y subunit A-10
TrEMBLK7LI340.0K7LI34_SOYBN; Uncharacterized protein
STRINGGLYMA10G10240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37943464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.27e-66nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]